PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2641_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family ZF-HD
Protein Properties Length: 321aa    MW: 35462.2 Da    PI: 7.0491
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2641_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.14.4e-33140194459
    ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     rYkeC++NhAa++G+h+vDGCgEfmps geegt++alkCaAC+CHRnFHR+e++ 
  Neem_2641_f_1 140 SRYKECQRNHAATMGSHVVDGCGEFMPS-GEEGTSDALKCAACDCHRNFHRKETDG 194
                    59*************************9.999*********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015662.6E-29141191IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.1E-30141192IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-20141194IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.294142191IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.609.6E-29240314IPR009057Homeodomain-like
SuperFamilySSF466898.97E-19242313IPR009057Homeodomain-like
TIGRFAMsTIGR015654.2E-27252309IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MELSDQDNEI EGMTRSLGYT RDSSSKVSST PINSAVGETG RDQNTVHVDD ETIFDPSETL  60
DQQLLFHHQL NQDHNKPSGN RDINPDPVQV SIAPTRATGA KTQQQLQQAE GNINRSIQRS  120
SGAAPRQALP PSPTISSPLS RYKECQRNHA ATMGSHVVDG CGEFMPSGEE GTSDALKCAA  180
CDCHRNFHRK ETDGEPHYAL PNSPPTAAIA PMMMTFGGGG SSGGLDESSS EDLNMYQSSA  240
RGQTSGQPRL SKKRFRTKFT QEQKDRMLEF AEKLGWRIQR QDEPGVLEFC NQIGVKRQVF  300
KVWMHNNKQS SKKKEASVRI N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-232533101875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425664.13e-99hypothetical protein CICLE_v10025926mg
RefseqXP_006466804.13e-99PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW75e-68ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLV4UHS44e-99V4UHS4_9R
STRINGPOPTR_0007s12970.13e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.12e-57homeobox protein 24